Back to your search result

Description

Product Source: E. coli, MEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEE-GAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA An additional amino acid (Met) is attached at the N-terminus., Alpha-synuclein is encoded by the SNCA gene (also known as NACP, PARK1) in human. There are two other known synuclein family members, beta- and gamma-synuclein. Interest in synuclein research started with the discovery of alpha-synuclein mutation in several families with autosomal dominant Parkinson's disease (PD). Alpha-synuclein is abundantly expressed in the brain and is found in a classic amyloid fibril form within the intra-neuronal Lewy body deposits of PD. The physiological function of synucleins is not well understood, but appears to involve membrane interactions, and in particular reversible binding to synaptic vesicle membranes. Contradictory evidences regarding inhibitory action of alpha-synuclein against phospholipase D (PLD) have been reported (PMID 11821392 & 19146388). Clone Syn211, Cat. No. 36-008-C detects epitope in the region from amino acid 121 to 125 and has been used together with clone LB509, Cat. No. MABN824, to characterize the digestion pattern of different forms of in vitro prepared alpha-synclulein aggregates (Guo, J.L., et al. 2013, PMID 23827677).

Structure formula

SAF-AG549

Miscellaneous

Certificate of Analysis (specimen)

Reference Material CoA specimen: for the current lot, please contact your customer service representative at info@labmix24.com

Product data sheet

View all available product details e.g. description, analytes/parameters, CAS Number, concentrations/values, sales unit/product format, method, source, transport information