Back to your search result

Description

A 42-mer synthetic peptide (GTNECLDNNGGCSHVCNDLKIGYECLCPDGFQLVAQRRCEDI-NH2) that contains a calcium binding site of EGF-A. Binds to the proprotein convertase subtilisin/kexin type 9 (PCSK9) in a pH and calcium-dependent manner (Kd = 300 nM at pH 5.2 and 1.0 microM at pH7.4 and at 2 mM calcium) and blocks its interaction with LDL receptors (IC50 = 3.4 microM) and VLDL receptors (IC50 = 4.7 microM). Acts as a poor inhibitor of PCSK9 - Apo-ER2 interaction even at high concentrations (~200 microM). Blocks the degradation of mature LDL receptors in HepG2 cells in a dose-dependent manner (~1.5 to 15 microM)., A 42-mer synthetic peptide (GTNECLDNNGGCSHVCNDLKIGYECLCPDGFQLVAQRRCEDI-NH2) that contains a calcium binding site of EGF-A. Binds to the proprotein convertase subtilisin/kexin type 9 (PCSK9) in a pH and calcium-dependent manner (Kd = 300 nM at pH 5.2 and 1.0 microM at pH7.4 and at 2 mM calcium) and blocks its interaction with LDL receptors (IC50 = 3.4 microM) and VLDL receptors (IC50 = 4.7 microM). Acts as a poor inhibitor of PCSK9 - Apo-ER2 interaction even at high concentrations (~200 microM). Blocks the degradation of mature LDL receptors in HepG2 cells in a dose-dependent manner (~1.5 to 15 microM).Please note that the molecular weight for this compound is batch-specific due to variable water content.

Structure formula

SAF-5087610001

Miscellaneous

Certificate of Analysis (specimen)

Reference Material CoA specimen: for the current lot, please contact your customer service representative at info@labmix24.com

Product data sheet

View all available product details e.g. description, analytes/parameters, CAS Number, concentrations/values, sales unit/product format, method, source, transport information